← All protocolsProtocol card Constituent peptides Citations
Grade AApprovedwarningBioGate · AMBER
Metabolic Reset - GLP-1 Anchored
Type 2 diabetes adjunct + obesity (BMI ≥ 30 or BMI ≥ 27 with comorbidity)
Eight audiences, one source of truth.
For clinicians
Dose & cycle
Semaglutide 0.25 mg → 0.5 mg → 1.0 mg → 2.0 mg SC weekly titration
Cycle
Continuous, 16-week titration
Duration
68 weeks per STEP-1 protocol
For patients
Monitoring endpoints
- ✓HbA1c
- ✓weight
- ✓lipase
- ✓CGM TIR
- ✓Oura resting HR
Contraindications
- ✕personal/family history of MTC
- ✕MEN-2
- ✕pregnancy
- ✕active gallbladder disease
Jurisdiction gates
US ✓
FDA approved (Wegovy/Ozempic)
EU ✓
EMA approved
UK ✓
MHRA approved
AU ✓
TGA approved
Provenance, attestations, and structures.
SemaglutidewarningBioGate · AMBER
Loading Mol* bundle…
HXEGTFTSDVSSYLEGQAAKEFIAWLVRGRGGLP-1 receptor agonist with extended half-life (~7 days); stimulates glucose-dependent insulin secretion and central appetite suppression.
IP economics
Cohort outcomes feed the royalty cascade.
Every revealed OEA from this protocol's cohorts updates the upstream IPNFT's outcome posterior. Holders receive pro-rata royalties from licensing, lab-fee escrow, and approved CRO contracts. Peptide MD does not custody the IPNFT; it indexes it through the Molecule registry.
IPNFT · Molecule IPNFT V2Solana
Semaglutide
4c0306…134702Royalty cascade
13.88%
Holders
18
Royalty cascade routes lab fees, licensing, and OEA-attested cohort revenues back to holders, the cohort treasury, and the originating researchers in a 60 / 25 / 15 split.
Every claim, traceable.
Grade A2021 · N Engl J Med
Once-Weekly Semaglutide in Adults with Overweight or Obesity (STEP 1)
Wilding JPH et al.