← All protocolsProtocol card Constituent peptides Citations
Grade BInvestigationalverifiedBioGate · GREENwarningBioGate · AMBER
Lean Mass & Recovery Stack
Off-label growth-hormone optimization for adults with confirmed somatopause profile
Eight audiences, one source of truth.
For clinicians
Dose & cycle
CJC-1295 w/ DAC 2 mg SC weekly + Ipamorelin 200 µg SC bid
Cycle
5 days on / 2 days off
Duration
12 weeks, retest IGF-1 at week 6 and week 12
For patients
Monitoring endpoints
- ✓IGF-1
- ✓fasting glucose
- ✓DEXA lean mass
- ✓Oura deep sleep minutes
Contraindications
- ✕active malignancy
- ✕diabetic retinopathy
- ✕pituitary adenoma
Jurisdiction gates
US ✓
Compounded under 503A
EU ✕
Not authorized
UK ✕
Unlicensed special order, prescriber liability
Provenance, attestations, and structures.
CJC-1295 (with DAC)verifiedBioGate · GREEN
Structural preview · ESMFold-2 mockdeterministic per sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRLong-acting GHRH analog with Drug Affinity Complex; binds serum albumin for ~8-day half-life.
IpamorelinwarningBioGate · AMBER
Structural preview · ESMFold-2 mockdeterministic per sequence
AHwFKPentapeptide ghrelin-receptor agonist; selectively stimulates GH release without significant cortisol or prolactin elevation.
IP economics
Cohort outcomes feed the royalty cascade.
Every revealed OEA from this protocol's cohorts updates the upstream IPNFT's outcome posterior. Holders receive pro-rata royalties from licensing, lab-fee escrow, and approved CRO contracts. Peptide MD does not custody the IPNFT; it indexes it through the Molecule registry.
IPNFT · Molecule IPNFT V2Solana
CJC-1295 (with DAC)
cb7d68…1dce7dRoyalty cascade
3.97%
Holders
380
Royalty cascade routes lab fees, licensing, and OEA-attested cohort revenues back to holders, the cohort treasury, and the originating researchers in a 60 / 25 / 15 split.
Every claim, traceable.
Grade A2006 · J Clin Endocrinol Metab
Prolonged stimulation of growth hormone (GH) and insulin-like growth factor I secretion by CJC-1295
Teichman SL et al.
Grade B1998 · Eur J Endocrinol
Ipamorelin, the first selective growth hormone secretagogue
Raun K et al.